PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PEQU_39718
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
Family TCP
Protein Properties Length: 137aa    MW: 15048 Da    PI: 10.4773
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PEQU_39718genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP120.91.5e-3762132272
         TCP   2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssase 72 
                 a+k+++++++hTkv+gR+RR+R++a+caar+F+L++eLG+++d++ti+WLlqqa+p+i ++tg+++++as+
  PEQU_39718  62 APKRSSNKDRHTKVEGRGRRIRMPALCAARIFQLTRELGHKSDGETIQWLLQQAEPSIMAATGSGTIPASA 132
                 789***************************************************************99965 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036341.6E-3067132IPR005333Transcription factor, TCP
PROSITE profilePS5136927.56768122IPR017887Transcription factor TCP subgroup
Sequence ? help Back to Top
Protein Sequence    Length: 137 aa     Download sequence    Send to blast
IMDPKSSSNI PPEQPKFLLN PDKRDPSRDS RDLQPLVPST SSLAEREPTS AVDKDEQRKQ  60
LAPKRSSNKD RHTKVEGRGR RIRMPALCAA RIFQLTRELG HKSDGETIQW LLQQAEPSIM  120
AATGSGTIPA SALAAAP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009420155.13e-55PREDICTED: transcription factor TCP20-like
SwissprotQ9LSD56e-48TCP20_ARATH; Transcription factor TCP20
TrEMBLM0S3K71e-55M0S3K7_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr1P27500_0013e-55(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP28643269
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27010.17e-47TCP family protein